PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G10580.1
Common NameF13M14.13, F18K10.17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 287aa    MW: 32738.3 Da    PI: 5.3759
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G10580.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding452.6e-1496140347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W++eE+ l++d+ +++G+g+Wk+I+r+  + R++ q+ s+ qky
      AT3G10580.1  96 PWSPEEHRLFLDGLNKYGKGDWKSISRECVTSRSPMQVASHAQKY 140
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM0071716456IPR001005SANT/Myb domain
PROSITE profilePS5129416.96489145IPR017930Myb domain
SuperFamilySSF466891.57E-1790146IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-1692144IPR006447Myb domain, plants
SMARTSM007172.6E-1093143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-1094140IPR009057Homeodomain-like
PfamPF002492.6E-1196140IPR001005SANT/Myb domain
CDDcd001672.64E-1196141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MDAAIPIWKR DDDKRFELAL VRFPAEGSPD FLENIAQFLQ KPLKEVYSYY QALVDDVTLI  60
ESGKYPLPKY PEDDYVSLPE ATKSKTQGTG KKKGIPWSPE EHRLFLDGLN KYGKGDWKSI  120
SRECVTSRSP MQVASHAQKY FLRQKNKKGK RFSIHDMTLG DAENVTVPVS NLNSMGQQPH  180
FDDQSPPDHY QDYFSQSNVT IPGCNMHFMG QQPRFGDQIP PGEYHPYSRD NVTVTGSNLN  240
SIGQQPHFND QISPDQYGRY LQENFGFFDD DGEDDGSLAS FQQLYKA
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258961_at0.0
Expression AtlasAT3G10580-
AtGenExpressAT3G10580-
ATTED-IIAT3G10580-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00344DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G10580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G10580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0115600.0AC011560.6 Arabidopsis thaliana chromosome 3 BAC F13M14 genomic sequence, complete sequence.
GenBankATAC0134280.0AC013428.6 Arabidopsis thaliana chromosome III BAC F18K10 genomic sequence, complete sequence.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187669.10.0homeodomain-like superfamily protein
TrEMBLQ9SQY80.0Q9SQY8_ARATH; Homeodomain-like superfamily protein
STRINGAT3G10580.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14731719
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]